PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01214g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 315aa    MW: 34319.6 Da    PI: 8.1272
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01214g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96e-4040101263
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                               k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rknkksss
  Niben101Scf01214g00004.1  40 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTAGGSLRNIPVGGGSRKNKKSSS 101
                               7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-262889IPR003851Zinc finger, Dof-type
PfamPF027017.7E-344198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1614498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPMEEIIQ NTNGSSKPNS CVERKVRPQK DQALNCPRCN STNTKFCYYN  60
NYSLSQPRYF CKTCRRYWTA GGSLRNIPVG GGSRKNKKSS SNSSSYSNHV NNPLKKLPDL  120
VNPPSHNHDQ NPSNIHIEGS QDLNLGFSSD FKTITELIQV PNYDGNNKDN NSPSISPLPP  180
PPPPSSSSSA SSSSQLSALE LINGITSRGM NNNSFMSMAS ISTDPNSVYN NSSGFSLPSL  240
NFSLDHGLGN AAYGNNIQET NTSGRFLFPF VGLKQISSTN TTNDGGNENN RDHHQPAEES  300
TNGFWNGMLG GGGSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766033.10.0PREDICTED: dof zinc finger protein DOF4.6-like
RefseqXP_016469483.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLM1AWI31e-137M1AWI3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319281e-137(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.12e-46Dof family protein